| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340884.1 | 5prime_partial | 172 | 714-196(-) |
Amino Acid sequence : | |||
| LAATRRGTINVVLTAKDVAVDGFCRSRCGSHGSTRGAERFLYAWVGNSEDLCPGYCAWPFHQPVYGPQSPPLVAPNDDVGADGMVINLATVLAGAATNPFNNGYFQGPASAPLEAVSACT GVFGSGAYPGYAGNVLMDKSSGGSYNAHGVKGREYLLPAMWDPLTSQCTTLI* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 15,366.841 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 69.270 | ||
| aromaticity | 0.007 | ||
| GRAVY | -0.526 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.141 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340884.1 | 5prime_partial | 137 | 3-416(+) |
Amino Acid sequence : | |||
| IFLPLKNMVKXKKNVQISTKSHPHNKPLPSARIFTCDTLAHTESSLLLPRPSSKSLSAISEPSQIKSVSYTATSAGPTWPAAGTHAPSLHAHCSCRHCSYPSTHCPRTPGTRPTQTRPYK RSPPPTAHSPAPESTRY* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,366.841 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 69.270 | ||
| aromaticity | 0.007 | ||
| GRAVY | -0.526 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.141 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340884.1 | complete | 135 | 271-678(+) |
Amino Acid sequence : | |||
| MRIVAAATALIHQHIARVPRVRARPKHARTSAHRLQRRTRRPLKVPVIERIRRRSRQHGRQIYHHAVRADVVIRRHERRRLRPVHRLVERPRAVARAQILRVTNPRVQKPLGAASGAVAA ASAPAEAVDGDVLSC* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,366.841 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 69.270 | ||
| aromaticity | 0.007 | ||
| GRAVY | -0.526 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.141 | ||
| sheet | 0.259 | ||