| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340885.1 | 5prime_partial | 196 | 824-234(-) |
Amino Acid sequence : | |||
| KQFVDETYSLGKTLTDPQIVNLAALGGHSAGTINVVLTAKDVAVDGFCRSRCGSHGSTRGAERFLYAWVGNSEDLCPGYCAWPFHQPVYGPQSPPLVAPNDDVGADGMVINLATVLAGAA TNPFNNGYFQGPASAPLEAVSACTGVFGSGAYPGYAGNVLMDKSSGGSYNAHGVKGREYLLPAMWDPLTSQCTTLI* | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 15,366.841 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 69.270 | ||
| aromaticity | 0.007 | ||
| GRAVY | -0.526 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.141 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340885.1 | 5prime_partial | 150 | 2-454(+) |
Amino Acid sequence : | |||
| SLKLSSSYFHIAIFFCHIFNMVKTKKNVQISTKSHPHNKPLPSARIFTCDTLAHTESSLLLPRPSSKSLSAISEPSQIKSVSYTATSAGPTWPAAGTHAPSLHAHCSCRHCSYPSTHCPR TPGTRPTQTRPYKRSPPPTAHSPAPESTRY* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 15,366.841 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 69.270 | ||
| aromaticity | 0.007 | ||
| GRAVY | -0.526 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.141 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340885.1 | complete | 135 | 309-716(+) |
Amino Acid sequence : | |||
| MRIVAAATALIHQHIARVPRVRARPKHARTSAHRLQRRTRRPLKVPVIERIRRRSRQHGRQIYHHAVRADVVIRRHERRRLRPVHRLVERPRAVARAQILRVTNPRVQKPLGAASGAVAA ASAPAEAVDGDVLSC* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,366.841 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 69.270 | ||
| aromaticity | 0.007 | ||
| GRAVY | -0.526 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.141 | ||
| sheet | 0.259 | ||