| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340894.1 | internal | 122 | 3-368(+) |
Amino Acid sequence : | |||
| RXSRDNLINTFRNPSLPRIHMPRQNIDLKTFAAITPTVACPPSEPEIIPEKKEDKFEWYENWYPVASVCDLDKRRPHGRKVIGIDVVVWWDRKENAWKVFDDTCPHRLAPLSEGRIDQWG RL | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 14,291.156 | ||
| Theoretical pI: | 8.532 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35980 36105 | ||
| Instability index: | 54.987 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.744 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.223 | ||
| sheet | 0.182 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340894.1 | internal | 122 | 3-368(+) |
Amino Acid sequence : | |||
| RXSRDNLINTFRNPSLPRIHMPRQNIDLKTFAAITPTVACPPSEPEIIPEKKEDKFEWYENWYPVASVCDLDKRRPHGRKVIGIDVVVWWDRKENAWKVFDDTCPHRLAPLSEGRIDQWG RL | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 14,291.156 | ||
| Theoretical pI: | 8.532 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35980 36105 | ||
| Instability index: | 54.987 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.744 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.223 | ||
| sheet | 0.182 | ||