| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340895.1 | internal | 155 | 466-2(-) |
Amino Acid sequence : | |||
| IPVRPGYSRLIFAGARNFAVQVDRFVPRWITHMSHNLIFDSDLFLLHVEERKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSC SVACKRLNALEIGLQAMSLVIEAKAVPVLGACYWI | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,851.415 | ||
| Theoretical pI: | 9.080 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40700 | ||
| Instability index: | 63.725 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.206 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340895.1 | internal | 155 | 466-2(-) |
Amino Acid sequence : | |||
| IPVRPGYSRLIFAGARNFAVQVDRFVPRWITHMSHNLIFDSDLFLLHVEERKLKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSC SVACKRLNALEIGLQAMSLVIEAKAVPVLGACYWI | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,851.415 | ||
| Theoretical pI: | 9.080 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40700 | ||
| Instability index: | 63.725 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.206 | ||
| sheet | 0.232 | ||