| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340896.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| VHGMTILLKLAKFNFNFLQNLYKKELYDLSRDRLAEAYLWGVGYHFEPQYSYVRKGVVLSIKIIGILDDTYDNYATVNEAQLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDA KKNGKKFASPYFKETIQLLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSI QETISEF | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 11,940.805 | ||
| Theoretical pI: | 9.409 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 16.702 | ||
| aromaticity | 0.160 | ||
| GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.440 | ||
| turn | 0.140 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340896.1 | 5prime_partial | 100 | 743-441(-) |
Amino Acid sequence : | |||
| KLRYRLLYRHTVLFHVAVHHGEHFSSLALTLVGTNVIPVATDQTSFYRKVWLILDPINGFLCKGFQAWYDRCKHDINATCYLRILQIVFEWRHLFFHNPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,940.805 | ||
| Theoretical pI: | 9.409 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 16.702 | ||
| aromaticity | 0.160 | ||
| GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.440 | ||
| turn | 0.140 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340896.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| VHGMTILLKLAKFNFNFLQNLYKKELYDLSRDRLAEAYLWGVGYHFEPQYSYVRKGVVLSIKIIGILDDTYDNYATVNEAQLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDA KKNGKKFASPYFKETIQLLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSI QETISEF | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 11,940.805 | ||
| Theoretical pI: | 9.409 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 16.702 | ||
| aromaticity | 0.160 | ||
| GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.440 | ||
| turn | 0.140 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340896.1 | 5prime_partial | 100 | 743-441(-) |
Amino Acid sequence : | |||
| KLRYRLLYRHTVLFHVAVHHGEHFSSLALTLVGTNVIPVATDQTSFYRKVWLILDPINGFLCKGFQAWYDRCKHDINATCYLRILQIVFEWRHLFFHNPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,940.805 | ||
| Theoretical pI: | 9.409 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 16.702 | ||
| aromaticity | 0.160 | ||
| GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.440 | ||
| turn | 0.140 | ||
| sheet | 0.210 | ||