| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340898.1 | internal | 144 | 434-3(-) |
Amino Acid sequence : | |||
| GTSRGITGLIAWLFEIGSNFIVSDSLVMLCGDQHSMDADGNHGTVFVVVLHCDLGLAIRPQPRTGAVFPDLSETGTELGGKNMAQRHQLRGVVRGIAKHVTLVTSTDFFWSFGEVAVNTL SNIRALLLNIHQNLKVSASRPXSS | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 11,114.384 | ||
| Theoretical pI: | 5.515 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 19.539 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.192 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340898.1 | 3prime_partial | 99 | 138-434(+) |
Amino Acid sequence : | |||
| MFGYATDDTPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEPRDQARYPPRST | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,114.384 | ||
| Theoretical pI: | 5.515 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 19.539 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.192 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340898.1 | internal | 144 | 434-3(-) |
Amino Acid sequence : | |||
| GTSRGITGLIAWLFEIGSNFIVSDSLVMLCGDQHSMDADGNHGTVFVVVLHCDLGLAIRPQPRTGAVFPDLSETGTELGGKNMAQRHQLRGVVRGIAKHVTLVTSTDFFWSFGEVAVNTL SNIRALLLNIHQNLKVSASRPXSS | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 11,114.384 | ||
| Theoretical pI: | 5.515 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 19.539 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.192 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340898.1 | 3prime_partial | 99 | 138-434(+) |
Amino Acid sequence : | |||
| MFGYATDDTPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEPRDQARYPPRST | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,114.384 | ||
| Theoretical pI: | 5.515 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 19.539 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.253 | ||
| turn | 0.192 | ||
| sheet | 0.263 | ||