| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340904.1 | 5prime_partial | 260 | 1-783(+) |
Amino Acid sequence : | |||
| ARPLRPPKCKTKILKFLSEEDVAAALAKYTADLSDKFVKEKGSFSVVLSGGTLIDTLRKLVESPYKESVDWEKWLIFWVDERVVPLDHEDSNYLLAWRGFLSKVPIPSSNIYPINDKLSP EGAAEDYEQRLRLLVEAKALPTSSITGFPKFDLMLLGMGPDGHVASLFPSRDQRYEKKRWVTFITDSPKPPPPRITFTFPVINSASEIAMVITGAELAETTKIALNGGGQLPGSPPLPAA EVSAEGELTWFLDKDAASKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 10,718.831 | ||
| Theoretical pI: | 8.022 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 45.259 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.375 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340904.1 | complete | 104 | 836-522(-) |
Amino Acid sequence : | |||
| MLPAQRDTNSIHGSARRTHSFEAASLSRNQVSSPSAETSAAGRGGEPGSCPPPFNAILVVSANSAPVITIAISEAEFITGNVNVIRGGGGFGESVMKVTQRFFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 10,718.831 | ||
| Theoretical pI: | 8.022 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 45.259 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.375 | ||
| sheet | 0.221 | ||