Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340904.1 | 5prime_partial | 260 | 1-783(+) |
Amino Acid sequence : | |||
ARPLRPPKCKTKILKFLSEEDVAAALAKYTADLSDKFVKEKGSFSVVLSGGTLIDTLRKLVESPYKESVDWEKWLIFWVDERVVPLDHEDSNYLLAWRGFLSKVPIPSSNIYPINDKLSP EGAAEDYEQRLRLLVEAKALPTSSITGFPKFDLMLLGMGPDGHVASLFPSRDQRYEKKRWVTFITDSPKPPPPRITFTFPVINSASEIAMVITGAELAETTKIALNGGGQLPGSPPLPAA EVSAEGELTWFLDKDAASKL* | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 10,718.831 | ||
Theoretical pI: | 8.022 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 45.259 | ||
aromaticity | 0.058 | ||
GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.375 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340904.1 | complete | 104 | 836-522(-) |
Amino Acid sequence : | |||
MLPAQRDTNSIHGSARRTHSFEAASLSRNQVSSPSAETSAAGRGGEPGSCPPPFNAILVVSANSAPVITIAISEAEFITGNVNVIRGGGGFGESVMKVTQRFFS* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 10,718.831 | ||
Theoretical pI: | 8.022 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 45.259 | ||
aromaticity | 0.058 | ||
GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.375 | ||
sheet | 0.221 |