| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340909.1 | 3prime_partial | 198 | 123-716(+) |
Amino Acid sequence : | |||
| MGMVFGEITTKARGNYKKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGK TQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDA | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 21,661.478 | ||
| Theoretical pI: | 6.494 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 27.233 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.217 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340909.1 | 3prime_partial | 198 | 123-716(+) |
Amino Acid sequence : | |||
| MGMVFGEITTKARGNYKKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGK TQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDA | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 21,661.478 | ||
| Theoretical pI: | 6.494 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 27.233 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.217 | ||
| sheet | 0.197 | ||