Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340909.1 | 3prime_partial | 198 | 123-716(+) |
Amino Acid sequence : | |||
MGMVFGEITTKARGNYKKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGK TQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDA | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 21,661.478 | ||
Theoretical pI: | 6.494 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 27.233 | ||
aromaticity | 0.051 | ||
GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.217 | ||
sheet | 0.197 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340909.1 | 3prime_partial | 198 | 123-716(+) |
Amino Acid sequence : | |||
MGMVFGEITTKARGNYKKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGK TQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDA | |||
Physicochemical properties | |||
Number of amino acids: | 198 | ||
Molecular weight: | 21,661.478 | ||
Theoretical pI: | 6.494 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 27.233 | ||
aromaticity | 0.051 | ||
GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.217 | ||
sheet | 0.197 |