| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340916.1 | complete | 156 | 40-510(+) |
Amino Acid sequence : | |||
| MPVITDEMRTAASEIYHGDEICQEKSKFLLTEVGLPNGLLPLKDIVECGYIKETGFVWLIQKEKTEHKFEKIGKLVQYATEVTAYVEPGRIRKLTGVKAKELLLWVSLTDINLDPTTAKI TFKSIAGLSRTFPVDAFVVEEKVNTTAASGDVVKEV* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,373.957 | ||
| Theoretical pI: | 5.507 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 28.096 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.044 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.160 | ||
| sheet | 0.276 | ||