Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340916.1 | complete | 156 | 40-510(+) |
Amino Acid sequence : | |||
MPVITDEMRTAASEIYHGDEICQEKSKFLLTEVGLPNGLLPLKDIVECGYIKETGFVWLIQKEKTEHKFEKIGKLVQYATEVTAYVEPGRIRKLTGVKAKELLLWVSLTDINLDPTTAKI TFKSIAGLSRTFPVDAFVVEEKVNTTAASGDVVKEV* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,373.957 | ||
Theoretical pI: | 5.507 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 28.096 | ||
aromaticity | 0.077 | ||
GRAVY | -0.044 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.160 | ||
sheet | 0.276 |