| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340918.1 | internal | 226 | 3-680(+) |
Amino Acid sequence : | |||
| TRVLSILNEEFLASKDYVPVKRDWLSAYWAGFKSPEQLSRIRNTGVKPEILKNVGKAITTLPETFKPHRAVKRIFEDRAKMIETGEGLDWAMGEALAFATLLVEGNHVRLSGQDVERGTF SHRHSVLHDQETGEKYCPLDHVMMNQNEEMFTVSNSSLSEFGVLGFELGYSMENPNSLVLWEAQFGDFANGAQVIFDQFVSSGEAKWLRQTGLVVLLPHGYDGQGP | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 25,378.384 | ||
| Theoretical pI: | 5.395 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 34950 | ||
| Instability index: | 30.785 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.311 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.243 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340918.1 | internal | 226 | 3-680(+) |
Amino Acid sequence : | |||
| TRVLSILNEEFLASKDYVPVKRDWLSAYWAGFKSPEQLSRIRNTGVKPEILKNVGKAITTLPETFKPHRAVKRIFEDRAKMIETGEGLDWAMGEALAFATLLVEGNHVRLSGQDVERGTF SHRHSVLHDQETGEKYCPLDHVMMNQNEEMFTVSNSSLSEFGVLGFELGYSMENPNSLVLWEAQFGDFANGAQVIFDQFVSSGEAKWLRQTGLVVLLPHGYDGQGP | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 25,378.384 | ||
| Theoretical pI: | 5.395 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 34950 | ||
| Instability index: | 30.785 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.311 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.243 | ||
| sheet | 0.279 | ||