| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340921.1 | 5prime_partial | 178 | 3-539(+) |
Amino Acid sequence : | |||
| TRAFMALQVYGAVPRTSMVQSSSSYGGMANQLCVGGDYALSMKRKERRLSMSLEVRASLDATAATAVAQVGQVTEVTKDTFWPIVKAAGDKTVVVDMYTQWCGPCKIMAPKFEQLSGKYN DVVFLKLDCNQENRPLAKELGIKVVPTFKILKDSKIVKEVTGAKFDDLVLAIETARSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,466.441 | ||
| Theoretical pI: | 9.157 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 30.432 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.044 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.191 | ||
| sheet | 0.264 | ||