Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340930.1 | internal | 187 | 2-562(+) |
Amino Acid sequence : | |||
HEASRRIRHEAGAYSEAAAGKAYPDCEAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGL NVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILADGIQDDSGNVTRFVMLPREPIIPR | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,551.212 | ||
Theoretical pI: | 5.826 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
Instability index: | 31.914 | ||
aromaticity | 0.053 | ||
GRAVY | -0.067 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.182 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340930.1 | internal | 187 | 2-562(+) |
Amino Acid sequence : | |||
HEASRRIRHEAGAYSEAAAGKAYPDCEAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALSQCEHTLTKMGL NVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILADGIQDDSGNVTRFVMLPREPIIPR | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,551.212 | ||
Theoretical pI: | 5.826 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
Instability index: | 31.914 | ||
aromaticity | 0.053 | ||
GRAVY | -0.067 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.182 | ||
sheet | 0.337 |