| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340937.1 | 5prime_partial | 148 | 479-33(-) |
Amino Acid sequence : | |||
| TRPRAEFGTRAVDQFCHGVFPSGPYYEHVIGYKQLSMKRPEHLMFVTYEEMMEDPSDCVEKLGNFLGCPFERKEEVEEIVKNCSIDVLRMYDVNKSEESPAWFPSPYSSFFRKGAVGDYK NYLNDEAIERIDALTKQKFHSLGFMYGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 12,203.757 | ||
| Theoretical pI: | 10.431 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
| Instability index: | 77.160 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.765 | ||
Secondary Structure Fraction | |||
| Helix | 0.155 | ||
| turn | 0.336 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340937.1 | 3prime_partial | 110 | 152-481(+) |
Amino Acid sequence : | |||
| MNCKAMGTKPEIPLTCSHHTFSIHQCCNSSQSLPLLLSVQTDTLRNYPISPRNRWDPPSSPRTSRTSSALASSCSVVCTRSRARSRAQKGRPHGRTDRPPSCRIRHEASC | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,203.757 | ||
| Theoretical pI: | 10.431 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
| Instability index: | 77.160 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.765 | ||
Secondary Structure Fraction | |||
| Helix | 0.155 | ||
| turn | 0.336 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340937.1 | 5prime_partial | 148 | 479-33(-) |
Amino Acid sequence : | |||
| TRPRAEFGTRAVDQFCHGVFPSGPYYEHVIGYKQLSMKRPEHLMFVTYEEMMEDPSDCVEKLGNFLGCPFERKEEVEEIVKNCSIDVLRMYDVNKSEESPAWFPSPYSSFFRKGAVGDYK NYLNDEAIERIDALTKQKFHSLGFMYGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 12,203.757 | ||
| Theoretical pI: | 10.431 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
| Instability index: | 77.160 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.765 | ||
Secondary Structure Fraction | |||
| Helix | 0.155 | ||
| turn | 0.336 | ||
| sheet | 0.155 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340937.1 | 3prime_partial | 110 | 152-481(+) |
Amino Acid sequence : | |||
| MNCKAMGTKPEIPLTCSHHTFSIHQCCNSSQSLPLLLSVQTDTLRNYPISPRNRWDPPSSPRTSRTSSALASSCSVVCTRSRARSRAQKGRPHGRTDRPPSCRIRHEASC | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,203.757 | ||
| Theoretical pI: | 10.431 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
| Instability index: | 77.160 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.765 | ||
Secondary Structure Fraction | |||
| Helix | 0.155 | ||
| turn | 0.336 | ||
| sheet | 0.155 | ||