| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340941.1 | complete | 181 | 137-682(+) |
Amino Acid sequence : | |||
| MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 15,449.354 | ||
| Theoretical pI: | 6.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
| Instability index: | 41.948 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.336 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.201 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340941.1 | 5prime_partial | 139 | 707-288(-) |
Amino Acid sequence : | |||
| IKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPG TVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,449.354 | ||
| Theoretical pI: | 6.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
| Instability index: | 41.948 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.336 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.201 | ||
| sheet | 0.216 | ||