Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340941.1 | complete | 181 | 137-682(+) |
Amino Acid sequence : | |||
MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 15,449.354 | ||
Theoretical pI: | 6.648 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
Instability index: | 41.948 | ||
aromaticity | 0.079 | ||
GRAVY | -0.336 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.201 | ||
sheet | 0.216 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340941.1 | 5prime_partial | 139 | 707-288(-) |
Amino Acid sequence : | |||
IKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPG TVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,449.354 | ||
Theoretical pI: | 6.648 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
Instability index: | 41.948 | ||
aromaticity | 0.079 | ||
GRAVY | -0.336 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.201 | ||
sheet | 0.216 |