| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340960.1 | internal | 150 | 3-452(+) |
Amino Acid sequence : | |||
| GEDRLALKDYRPPRQTAKAKINRASAPKLPKARSLFPLKIDKVARFEVDKTTKGVADESILLENITVDTSKFLKFDVFVNDEDDAPNELDKAAYAGTYAQVPHKSDNGKATSSIKLKLTE LYEDMDIDDDDSIVATIVPRHDGPGDTIGG | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 14,827.589 | ||
| Theoretical pI: | 8.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 39.896 | ||
| aromaticity | 0.128 | ||
| GRAVY | 0.350 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.369 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340960.1 | 5prime_partial | 141 | 454-29(-) |
Amino Acid sequence : | |||
| IPPMVSPGPSWRGTIVATIESSSSMSISSYSSVNFSFIDDVAFPLSLLCGTCAYVPAYAALSNSFGASSSSFTNTSNFKNFDVSTVMFSSKMDSSATPFVVLSTSNLATLSIFSGKRDRA FGSLGAEARFIFAFAVCRGGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 14,827.589 | ||
| Theoretical pI: | 8.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 39.896 | ||
| aromaticity | 0.128 | ||
| GRAVY | 0.350 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.369 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340960.1 | internal | 150 | 3-452(+) |
Amino Acid sequence : | |||
| GEDRLALKDYRPPRQTAKAKINRASAPKLPKARSLFPLKIDKVARFEVDKTTKGVADESILLENITVDTSKFLKFDVFVNDEDDAPNELDKAAYAGTYAQVPHKSDNGKATSSIKLKLTE LYEDMDIDDDDSIVATIVPRHDGPGDTIGG | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 14,827.589 | ||
| Theoretical pI: | 8.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 39.896 | ||
| aromaticity | 0.128 | ||
| GRAVY | 0.350 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.369 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340960.1 | 5prime_partial | 141 | 454-29(-) |
Amino Acid sequence : | |||
| IPPMVSPGPSWRGTIVATIESSSSMSISSYSSVNFSFIDDVAFPLSLLCGTCAYVPAYAALSNSFGASSSSFTNTSNFKNFDVSTVMFSSKMDSSATPFVVLSTSNLATLSIFSGKRDRA FGSLGAEARFIFAFAVCRGGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 14,827.589 | ||
| Theoretical pI: | 8.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 39.896 | ||
| aromaticity | 0.128 | ||
| GRAVY | 0.350 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.369 | ||
| sheet | 0.199 | ||