| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340969.1 | internal | 240 | 2-721(+) |
Amino Acid sequence : | |||
| PKVTVSDSSPDAWQTSPISNTVSSPGDARRRKRGRRSDYATPSPMPSASHARTPEPTAAATPSSADDVPPSSDAGDGNEDEAPVVYVWGTNISVQDVNAAILRFLRHFREDPQQIEGKYM RMINHVIEMEGDSLDVDAHDVYDYDNDLYNKMVKYPLEVLAIFDMVLMDMVGRINPLFEKHIQARIFNLRSSTSMRNLNPSDVEKMVSLKGMIIRCSSIIPEIREAVFRCLVCGYYSDPI | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 26,856.031 | ||
| Theoretical pI: | 5.149 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 65.610 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.417 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.271 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340969.1 | internal | 240 | 2-721(+) |
Amino Acid sequence : | |||
| PKVTVSDSSPDAWQTSPISNTVSSPGDARRRKRGRRSDYATPSPMPSASHARTPEPTAAATPSSADDVPPSSDAGDGNEDEAPVVYVWGTNISVQDVNAAILRFLRHFREDPQQIEGKYM RMINHVIEMEGDSLDVDAHDVYDYDNDLYNKMVKYPLEVLAIFDMVLMDMVGRINPLFEKHIQARIFNLRSSTSMRNLNPSDVEKMVSLKGMIIRCSSIIPEIREAVFRCLVCGYYSDPI | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 26,856.031 | ||
| Theoretical pI: | 5.149 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 65.610 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.417 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.271 | ||
| sheet | 0.217 | ||