| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340995.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
| ARGRLPPRAADMTEARRLRGHNAAATCCIASKFNPGFIATAAEDGRVCWYDLRCKDMLFSMDVGNGNPVSSLCFKPGNEEIIYISVENEVKCFDLHVPTSWKQLESYHYHKDEINHIACH PKSSFLAAANDAGDVKIVDVRQQCL | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,157.215 | ||
| Theoretical pI: | 6.646 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17460 | ||
| Instability index: | 48.306 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.221 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340995.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
| ARGRLPPRAADMTEARRLRGHNAAATCCIASKFNPGFIATAAEDGRVCWYDLRCKDMLFSMDVGNGNPVSSLCFKPGNEEIIYISVENEVKCFDLHVPTSWKQLESYHYHKDEINHIACH PKSSFLAAANDAGDVKIVDVRQQCL | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,157.215 | ||
| Theoretical pI: | 6.646 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17460 | ||
| Instability index: | 48.306 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.307 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.221 | ||
| sheet | 0.248 | ||