Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341011.1 | complete | 191 | 143-718(+) |
Amino Acid sequence : | |||
MITTPPQIHSLWNSPYRSSNQPEISIALTSGFFTSSFGTVTVSTPFSIAAFTWSSFAFSGSLKRRRNFPLLLSTRCHLSFFSSCSLLLSPLICKMLASSTSTLTSSFFNPGTSTLNTWAS GVSFQSIRALATALVSRAEDGRLATAVEKGNPSKGSQISNENGSKTLLRRLPKNLGMIDILVFRNRVCLCC* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 20,852.559 | ||
Theoretical pI: | 9.396 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 51.143 | ||
aromaticity | 0.076 | ||
GRAVY | -0.620 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.223 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341011.1 | 5prime_partial | 184 | 756-202(-) |
Amino Acid sequence : | |||
ARGAIQKKPPSITQQHKHTLFLKTKMSIIPRFFGSRRSNVFDPFSLDIWDPFEGFPFSTAVANLPSSARETSAVANARIDWKETPEAHVFKVDVPGLKKEEVKVEVEEASILQISGERSK EQEEKNDKWHRVERSSGKFLRRFRLPENAKLDQVKAAMENGVLTVTVPKEEVKKPEVKAIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 20,852.559 | ||
Theoretical pI: | 9.396 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 51.143 | ||
aromaticity | 0.076 | ||
GRAVY | -0.620 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.223 | ||
sheet | 0.245 |