Acc_NO	ORF type	length	start-end position (strand +/-)
>DY341020.1	5prime_partial	129	3-392(+)
Amino Acid sequence :
TRCPFWILARMVLQMRGVIASGHKWDVMVDLFFYREPEEAKEPEQEEAPALDYADYGSAAIGGDWSSAQIPEAQWAPDLAGAGQPVAGGWSAADSGADGWDAAAAPPPPAAAAVLPTSAP VDVTPGGWE*
Physicochemical properties
Number of amino acids:		129
Molecular weight:		12,433.169
Theoretical pI:		10.290
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11125
Instability index:		48.645
aromaticity		0.046
GRAVY		0.781
Secondary Structure Fraction
Helix		0.481
turn		0.176
sheet		0.370

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY341020.1	complete	108	79-405(+)
Amino Acid sequence :
MSWLICFSIGSLKRLRNLSRRKLQLLIMLIMDLQQLVEIGLVPKSRRPNGLLIWLVQVNQLLVVGVLQIQVLMDGMQLLLHLHQPLLLFCQHLLLLTSLQVAGNEMFL*
Physicochemical properties
Number of amino acids:		108
Molecular weight:		12,433.169
Theoretical pI:		10.290
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11125
Instability index:		48.645
aromaticity		0.046
GRAVY		0.781
Secondary Structure Fraction
Helix		0.481
turn		0.176
sheet		0.370