| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341026.1 | internal | 172 | 1-516(+) |
Amino Acid sequence : | |||
| ARGLPSNSARGITQISKKLIKPFTPTPENLKNYSISFLDKCMEHMNFAVILFYKSKPENITHLEESLAKILVQFYPLAGRYIKNDHIVDCSDQGVEFIEAEALDVELLDLIAKIETEQLN ALLPYQYLRLDEADPILGIKVTRFSDDGVSIAVSVHHTIFDMSSLGTFIAAW | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 19,359.056 | ||
| Theoretical pI: | 5.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 34.261 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.031 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.203 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341026.1 | internal | 172 | 1-516(+) |
Amino Acid sequence : | |||
| ARGLPSNSARGITQISKKLIKPFTPTPENLKNYSISFLDKCMEHMNFAVILFYKSKPENITHLEESLAKILVQFYPLAGRYIKNDHIVDCSDQGVEFIEAEALDVELLDLIAKIETEQLN ALLPYQYLRLDEADPILGIKVTRFSDDGVSIAVSVHHTIFDMSSLGTFIAAW | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 19,359.056 | ||
| Theoretical pI: | 5.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 34.261 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.031 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.203 | ||
| sheet | 0.279 | ||