Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341032.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
FMHKTWGALPSFYIDSTGLSAAVELEIPDILEDHGRLMSLSELSAASGCPREPLYRLMRFLIFHGIFTGSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLR SIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSAVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPP | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 13,460.117 | ||
Theoretical pI: | 11.118 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 55.700 | ||
aromaticity | 0.016 | ||
GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.268 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341032.1 | 3prime_partial | 136 | 408-1(-) |
Amino Acid sequence : | |||
MVAVGRVAPRILTSDRPEIKACPRFQGFAAQAGRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGSGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQPR GVDVKGGQCSPCLVHE | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 13,460.117 | ||
Theoretical pI: | 11.118 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 55.700 | ||
aromaticity | 0.016 | ||
GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.268 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341032.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
HAQDMGSTALLLHRLHGAVCGGGAGDSRHPGRSRPPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHRIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCRLERRSLENGDKPLSQV DQR* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,460.117 | ||
Theoretical pI: | 11.118 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 55.700 | ||
aromaticity | 0.016 | ||
GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.268 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341032.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
FMHKTWGALPSFYIDSTGLSAAVELEIPDILEDHGRLMSLSELSAASGCPREPLYRLMRFLIFHGIFTGSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLR SIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSAVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPP | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 13,460.117 | ||
Theoretical pI: | 11.118 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 55.700 | ||
aromaticity | 0.016 | ||
GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.268 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341032.1 | 3prime_partial | 136 | 408-1(-) |
Amino Acid sequence : | |||
MVAVGRVAPRILTSDRPEIKACPRFQGFAAQAGRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGSGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQPR GVDVKGGQCSPCLVHE | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 13,460.117 | ||
Theoretical pI: | 11.118 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 55.700 | ||
aromaticity | 0.016 | ||
GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.268 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341032.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
HAQDMGSTALLLHRLHGAVCGGGAGDSRHPGRSRPPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHRIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCRLERRSLENGDKPLSQV DQR* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,460.117 | ||
Theoretical pI: | 11.118 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 55.700 | ||
aromaticity | 0.016 | ||
GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.268 | ||
sheet | 0.293 |