| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341032.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
| FMHKTWGALPSFYIDSTGLSAAVELEIPDILEDHGRLMSLSELSAASGCPREPLYRLMRFLIFHGIFTGSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLR SIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSAVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPP | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 13,460.117 | ||
| Theoretical pI: | 11.118 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 55.700 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.268 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341032.1 | 3prime_partial | 136 | 408-1(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRPEIKACPRFQGFAAQAGRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGSGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQPR GVDVKGGQCSPCLVHE | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 13,460.117 | ||
| Theoretical pI: | 11.118 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 55.700 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.268 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341032.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
| HAQDMGSTALLLHRLHGAVCGGGAGDSRHPGRSRPPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHRIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCRLERRSLENGDKPLSQV DQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,460.117 | ||
| Theoretical pI: | 11.118 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 55.700 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.268 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341032.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
| FMHKTWGALPSFYIDSTGLSAAVELEIPDILEDHGRLMSLSELSAASGCPREPLYRLMRFLIFHGIFTGSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLR SIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSAVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPP | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 13,460.117 | ||
| Theoretical pI: | 11.118 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 55.700 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.268 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341032.1 | 3prime_partial | 136 | 408-1(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRPEIKACPRFQGFAAQAGRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGSGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQPR GVDVKGGQCSPCLVHE | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 13,460.117 | ||
| Theoretical pI: | 11.118 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 55.700 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.268 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341032.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
| HAQDMGSTALLLHRLHGAVCGGGAGDSRHPGRSRPPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHRIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCRLERRSLENGDKPLSQV DQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,460.117 | ||
| Theoretical pI: | 11.118 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 55.700 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.610 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.268 | ||
| sheet | 0.293 | ||