| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341034.1 | internal | 218 | 1-654(+) |
Amino Acid sequence : | |||
| EEMDSDYRFARELSDLQTLRSHYQPQLPPCLQGNAIRVEFGDETTTADPSGAHTISRSFPHTYGQPLAHFLKATVTVPEAQIISDYPSVRVGVVFCGRQSPGGHNVIWGLFEALKFHNPE SVLLGFLGGSEGLFAQKTLEISDEILATYKNQGGYDLLGRTKDQIRTTKQVDAALKACTDLKLDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIP | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 23,750.537 | ||
| Theoretical pI: | 5.503 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 43.223 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.225 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341034.1 | internal | 218 | 1-654(+) |
Amino Acid sequence : | |||
| EEMDSDYRFARELSDLQTLRSHYQPQLPPCLQGNAIRVEFGDETTTADPSGAHTISRSFPHTYGQPLAHFLKATVTVPEAQIISDYPSVRVGVVFCGRQSPGGHNVIWGLFEALKFHNPE SVLLGFLGGSEGLFAQKTLEISDEILATYKNQGGYDLLGRTKDQIRTTKQVDAALKACTDLKLDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIP | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 23,750.537 | ||
| Theoretical pI: | 5.503 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 43.223 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.225 | ||
| sheet | 0.248 | ||