Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341059.1 | 5prime_partial | 168 | 3-509(+) |
Amino Acid sequence : | |||
KTHPTLIGSFYSKTKAMVEELLKEFDNVCSLRVRMPISSDLENPRNFITKISRYNKVVSIPNSMTVLDELLPISIVMAKRNLRGIWNYTNPGVVSHNEILEMYKKYIDPDFKWTSFTLEE QAKVIIAPRSNNELDASKLKKEFPELLSIKESLIEYVFEPNQKTTPAT* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 19,399.233 | ||
Theoretical pI: | 8.580 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 36.701 | ||
aromaticity | 0.089 | ||
GRAVY | -0.348 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.244 | ||
sheet | 0.250 |