| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341059.1 | 5prime_partial | 168 | 3-509(+) |
Amino Acid sequence : | |||
| KTHPTLIGSFYSKTKAMVEELLKEFDNVCSLRVRMPISSDLENPRNFITKISRYNKVVSIPNSMTVLDELLPISIVMAKRNLRGIWNYTNPGVVSHNEILEMYKKYIDPDFKWTSFTLEE QAKVIIAPRSNNELDASKLKKEFPELLSIKESLIEYVFEPNQKTTPAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 19,399.233 | ||
| Theoretical pI: | 8.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 36.701 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.348 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.244 | ||
| sheet | 0.250 | ||