| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341064.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
| VNAEGLLSLYEASPVRFHNEKILEEAERFTRQELSCMESKLQSPLKDKVKRALERPLHREVPILYARHFISIYEKDESMDEHLLKLAKFNFNFLQNLYKKELYDLSRWWNKFDLKTKLPY IRDRLAEAYLWGVGYHFEPQYSYVRKGVVLSIKIIGILDDTYDNYATVNEAQLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQLLARGYNQELKW VMEKQMPPFKDYLKNSEITSCIYIMFASI | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 32,257.789 | ||
| Theoretical pI: | 6.683 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55810 55935 | ||
| Instability index: | 46.324 | ||
| aromaticity | 0.141 | ||
| GRAVY | -0.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.164 | ||
| sheet | 0.297 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341064.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
| VNAEGLLSLYEASPVRFHNEKILEEAERFTRQELSCMESKLQSPLKDKVKRALERPLHREVPILYARHFISIYEKDESMDEHLLKLAKFNFNFLQNLYKKELYDLSRWWNKFDLKTKLPY IRDRLAEAYLWGVGYHFEPQYSYVRKGVVLSIKIIGILDDTYDNYATVNEAQLFTEILDRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQLLARGYNQELKW VMEKQMPPFKDYLKNSEITSCIYIMFASI | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 32,257.789 | ||
| Theoretical pI: | 6.683 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55810 55935 | ||
| Instability index: | 46.324 | ||
| aromaticity | 0.141 | ||
| GRAVY | -0.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.164 | ||
| sheet | 0.297 | ||