| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341068.1 | internal | 219 | 2-658(+) |
Amino Acid sequence : | |||
| AVDKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDE IARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVKQAAKSIVANGLARRCIV | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 15,919.511 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 20.023 | ||
| aromaticity | 0.006 | ||
| GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.269 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341068.1 | 5prime_partial | 156 | 658-188(-) |
Amino Acid sequence : | |||
| HDAPPCEPVGNDALGRLLDNVGATPVDLGGVLPGEGTATVGPPPAVGVDDDLTTGETCVSVGPTDDETPGGVKVEDGFLVQILLRDHRLDDVLLEIPGDLVVGDGLVVLGRDEDGVDPDG DHRTVLVVVLDRDLGLPVGSQPRARAVLADLGQTST* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 15,919.511 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 20.023 | ||
| aromaticity | 0.006 | ||
| GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.269 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341068.1 | internal | 219 | 2-658(+) |
Amino Acid sequence : | |||
| AVDKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDE IARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVKQAAKSIVANGLARRCIV | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 15,919.511 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 20.023 | ||
| aromaticity | 0.006 | ||
| GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.269 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341068.1 | 5prime_partial | 156 | 658-188(-) |
Amino Acid sequence : | |||
| HDAPPCEPVGNDALGRLLDNVGATPVDLGGVLPGEGTATVGPPPAVGVDDDLTTGETCVSVGPTDDETPGGVKVEDGFLVQILLRDHRLDDVLLEIPGDLVVGDGLVVLGRDEDGVDPDG DHRTVLVVVLDRDLGLPVGSQPRARAVLADLGQTST* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 15,919.511 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 20.023 | ||
| aromaticity | 0.006 | ||
| GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.269 | ||
| sheet | 0.231 | ||