| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341071.1 | internal | 166 | 499-2(-) |
Amino Acid sequence : | |||
| QFDIVTGCIYWILLQCDISIKAWNPSSLITNQSLLQYSVTSLENEELLFISFEGSSYSTKFPCDNTNTISLCMIVGTLCATVITVHLTNSPLIIFCKRASVAESIEAVASSRTNILFPLR RTLPMHNSCLCPMLQFSPSSLTQESSKFGISLIVGLSWHFSRASHI | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 15,027.321 | ||
| Theoretical pI: | 5.618 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 37.443 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.209 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341071.1 | 5prime_partial | 134 | 3-407(+) |
Amino Acid sequence : | |||
| IWEALEKCQLKPTISEMPNLLDSCVSDEGENWSMGQRQLLCMGRVLLRGNKILVLDEATASIDSATDALLQKIIRGEFVKCTVITVAHRVPTIMHSDMVLVLSHGNLVEYDEPSKLMKSN SSFSKLVTEYCKRD* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,027.321 | ||
| Theoretical pI: | 5.618 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 37.443 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.209 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341071.1 | internal | 166 | 499-2(-) |
Amino Acid sequence : | |||
| QFDIVTGCIYWILLQCDISIKAWNPSSLITNQSLLQYSVTSLENEELLFISFEGSSYSTKFPCDNTNTISLCMIVGTLCATVITVHLTNSPLIIFCKRASVAESIEAVASSRTNILFPLR RTLPMHNSCLCPMLQFSPSSLTQESSKFGISLIVGLSWHFSRASHI | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 15,027.321 | ||
| Theoretical pI: | 5.618 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 37.443 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.209 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341071.1 | 5prime_partial | 134 | 3-407(+) |
Amino Acid sequence : | |||
| IWEALEKCQLKPTISEMPNLLDSCVSDEGENWSMGQRQLLCMGRVLLRGNKILVLDEATASIDSATDALLQKIIRGEFVKCTVITVAHRVPTIMHSDMVLVLSHGNLVEYDEPSKLMKSN SSFSKLVTEYCKRD* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,027.321 | ||
| Theoretical pI: | 5.618 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 37.443 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.209 | ||
| sheet | 0.291 | ||