Acc_NO	ORF type	length	start-end position (strand +/-)
>DY341090.1	5prime_partial	139	1-420(+)
Amino Acid sequence :
ARGLPSNSARGGDAVCKQKSIELLEKINMPKGLLPLDDIVEVGHNAETGFVWLKQKKSKTHYFKGIGRSVWYDTEVTAFVSDRRMKRLTGVKSKEILIWITICDISIKDPESGKITFGTP TGISRAFPVSAFEEEEEKK*
Physicochemical properties
Number of amino acids:		139
Molecular weight:		15,527.719
Theoretical pI:		9.080
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19605
Instability index:		50.478
aromaticity		0.079
GRAVY		-0.395
Secondary Structure Fraction
Helix		0.295
turn		0.230
sheet		0.216