| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341096.1 | 5prime_partial | 201 | 715-110(-) |
Amino Acid sequence : | |||
| SISVLLRFLQRIGFVQCFSSLHVSAAIKNVFHYRSSLDLPWMVLQLMRQVIGEFGFPVHHFGENGGHNFRQNSKNVGVEESNRGQPGADGGAVDEGEAFLGLEFEEAAVDAGELEGLVGV EGFAGGAAGFGVGAAGEEAGDVGQGDQVAGGGDGAAEGEAGGDVVVEEFGDGFQDLESDAGISLQKSVDCDEHGCSCCCVW* | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 16,040.679 | ||
| Theoretical pI: | 9.143 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 99.453 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.671 | ||
Secondary Structure Fraction | |||
| Helix | 0.115 | ||
| turn | 0.481 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341096.1 | complete | 156 | 69-539(+) |
Amino Acid sequence : | |||
| MLEYSEMGQNPTAHYHTQQQEQPCSSQSTLFCRDIPASDSKSWKPSPNSSTTTSPPASPSAAPSPPPATWSPCPTSPASSPAAPTPKPAAPPANPSTPTKPSSSPASTAASSNSSPRKAS PSSTAPPSAPGWPRLLSSTPTFLLFCLKLCPPFSPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 16,040.679 | ||
| Theoretical pI: | 9.143 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 99.453 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.671 | ||
Secondary Structure Fraction | |||
| Helix | 0.115 | ||
| turn | 0.481 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341096.1 | 5prime_partial | 201 | 715-110(-) |
Amino Acid sequence : | |||
| SISVLLRFLQRIGFVQCFSSLHVSAAIKNVFHYRSSLDLPWMVLQLMRQVIGEFGFPVHHFGENGGHNFRQNSKNVGVEESNRGQPGADGGAVDEGEAFLGLEFEEAAVDAGELEGLVGV EGFAGGAAGFGVGAAGEEAGDVGQGDQVAGGGDGAAEGEAGGDVVVEEFGDGFQDLESDAGISLQKSVDCDEHGCSCCCVW* | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 16,040.679 | ||
| Theoretical pI: | 9.143 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 99.453 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.671 | ||
Secondary Structure Fraction | |||
| Helix | 0.115 | ||
| turn | 0.481 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341096.1 | complete | 156 | 69-539(+) |
Amino Acid sequence : | |||
| MLEYSEMGQNPTAHYHTQQQEQPCSSQSTLFCRDIPASDSKSWKPSPNSSTTTSPPASPSAAPSPPPATWSPCPTSPASSPAAPTPKPAAPPANPSTPTKPSSSPASTAASSNSSPRKAS PSSTAPPSAPGWPRLLSSTPTFLLFCLKLCPPFSPK* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 16,040.679 | ||
| Theoretical pI: | 9.143 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 99.453 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.671 | ||
Secondary Structure Fraction | |||
| Helix | 0.115 | ||
| turn | 0.481 | ||
| sheet | 0.199 | ||