Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341098.1 | 5prime_partial | 160 | 2-484(+) |
Amino Acid sequence : | |||
APRLLGKKRYSDRNILCCLLCQQEKAAMEQNETGCQTPQAPIMCVNNCGFFGTAATMNMCSKCYKDVVLKQEQAKLAASSIQSIVNGSSDVAIVTETKNAPSGVVAVASPQSSSAAPASE QAEEAKQGPKRCGMCRKRVGLTGFNCKCGQHFLLDPPLRH* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 14,798.751 | ||
Theoretical pI: | 8.554 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40365 | ||
Instability index: | 58.501 | ||
aromaticity | 0.104 | ||
GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.289 | ||
sheet | 0.244 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341098.1 | complete | 142 | 103-531(+) |
Amino Acid sequence : | |||
MPNSSSTHHVCKQLRILRDSSYHEHVLKVLQRRCLEARTSKIGCFFDPEHRQWEFRCCYSNRNKERPLGRRGSGIATIIICRTRKRAGRGSQTRSKKMRHVPETRGFNRLQLQMWPTFSA RPTATPLNPSALSTTVRPGRKP* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 14,798.751 | ||
Theoretical pI: | 8.554 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40365 | ||
Instability index: | 58.501 | ||
aromaticity | 0.104 | ||
GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.289 | ||
sheet | 0.244 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341098.1 | 5prime_partial | 135 | 597-190(-) |
Amino Acid sequence : | |||
DENKWARISCQPYLPSQLGWPWLWLPSRPNGSGKGTRVQWRSGGSSRKCWPHLQLKPVKPTRFRHMPHLFGPCLASSACSLAGAADDDCGDATATTPEGAFFVSVTIATSELPLTMLWIE EAANFACSCFKTTSL* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 14,798.751 | ||
Theoretical pI: | 8.554 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40365 | ||
Instability index: | 58.501 | ||
aromaticity | 0.104 | ||
GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.289 | ||
sheet | 0.244 |