| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341098.1 | 5prime_partial | 160 | 2-484(+) |
Amino Acid sequence : | |||
| APRLLGKKRYSDRNILCCLLCQQEKAAMEQNETGCQTPQAPIMCVNNCGFFGTAATMNMCSKCYKDVVLKQEQAKLAASSIQSIVNGSSDVAIVTETKNAPSGVVAVASPQSSSAAPASE QAEEAKQGPKRCGMCRKRVGLTGFNCKCGQHFLLDPPLRH* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 14,798.751 | ||
| Theoretical pI: | 8.554 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40365 | ||
| Instability index: | 58.501 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.289 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341098.1 | complete | 142 | 103-531(+) |
Amino Acid sequence : | |||
| MPNSSSTHHVCKQLRILRDSSYHEHVLKVLQRRCLEARTSKIGCFFDPEHRQWEFRCCYSNRNKERPLGRRGSGIATIIICRTRKRAGRGSQTRSKKMRHVPETRGFNRLQLQMWPTFSA RPTATPLNPSALSTTVRPGRKP* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 14,798.751 | ||
| Theoretical pI: | 8.554 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40365 | ||
| Instability index: | 58.501 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.289 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341098.1 | 5prime_partial | 135 | 597-190(-) |
Amino Acid sequence : | |||
| DENKWARISCQPYLPSQLGWPWLWLPSRPNGSGKGTRVQWRSGGSSRKCWPHLQLKPVKPTRFRHMPHLFGPCLASSACSLAGAADDDCGDATATTPEGAFFVSVTIATSELPLTMLWIE EAANFACSCFKTTSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 14,798.751 | ||
| Theoretical pI: | 8.554 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39990 40365 | ||
| Instability index: | 58.501 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.289 | ||
| sheet | 0.244 | ||