| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341113.1 | 5prime_partial | 118 | 3-359(+) |
Amino Acid sequence : | |||
| KMGNPYLARIINSEELQSVVKPIKKEIKRAPLKDNPLKNLNVMLKLNPYAKAAKRMALLPEAQRVKAKQEKLDKKRNTITKEEAGAIKTASKNWYKTMISDSDYTEFENFTKWLGVSH* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,574.741 | ||
| Theoretical pI: | 9.925 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 39.658 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.769 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.203 | ||
| sheet | 0.297 | ||