| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341117.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
| STTLQTSTPPFTATDRVFNFAAGPATLPENVLLKAQSELYNWRGSGMSVMEMSHRGKEFLSIIQKAESNLRNLLNIPSDYSVLFLQGGATTQFAAVPLNLCKPGDTVDYIVTGSWGDKAF REAAKYCNPKSIWSGKSEKYTKIPKFDSLEQTPGAKYLHICANETIHGVEFKSYPTPASESEVLIADMSSNFCSKPVDVTKFGLIYAGAQKNVGPSGVTIAIVRSDLIGNSQPITPVMLD YKIHADDNSLYN | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 14,719.804 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 104.999 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.307 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341117.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
| LHNPTNLHAPLHRHRSRLQLRRRSRNPTGKRPPESPIGALQLARIRHVGDGDEPPWQGVPLHHPEGGIKSPKSAQHPLRLLRPLPPGRRHHSVRRRPPQPLQTRRHRGLHRHRILGRQGL QRGREIL* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,719.804 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 104.999 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.307 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341117.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
| STTLQTSTPPFTATDRVFNFAAGPATLPENVLLKAQSELYNWRGSGMSVMEMSHRGKEFLSIIQKAESNLRNLLNIPSDYSVLFLQGGATTQFAAVPLNLCKPGDTVDYIVTGSWGDKAF REAAKYCNPKSIWSGKSEKYTKIPKFDSLEQTPGAKYLHICANETIHGVEFKSYPTPASESEVLIADMSSNFCSKPVDVTKFGLIYAGAQKNVGPSGVTIAIVRSDLIGNSQPITPVMLD YKIHADDNSLYN | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 14,719.804 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 104.999 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.307 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341117.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
| LHNPTNLHAPLHRHRSRLQLRRRSRNPTGKRPPESPIGALQLARIRHVGDGDEPPWQGVPLHHPEGGIKSPKSAQHPLRLLRPLPPGRRHHSVRRRPPQPLQTRRHRGLHRHRILGRQGL QRGREIL* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,719.804 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 104.999 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.307 | ||
| sheet | 0.197 | ||