Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341119.1 | internal | 112 | 337-2(-) |
Amino Acid sequence : | |||
EEALGNGKPTVVEFYADWCEVCRELAPDVYKVDQQYKGKVIFVMLNGDNLKWEQELDEFGVGGIPHFPFLDREGNAEGNVVGRLPRQSRLENVDPLARGEASVPHARVMGQF | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,591.019 | ||
Theoretical pI: | 4.764 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 17.519 | ||
aromaticity | 0.098 | ||
GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.241 | ||
sheet | 0.268 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341119.1 | internal | 112 | 337-2(-) |
Amino Acid sequence : | |||
EEALGNGKPTVVEFYADWCEVCRELAPDVYKVDQQYKGKVIFVMLNGDNLKWEQELDEFGVGGIPHFPFLDREGNAEGNVVGRLPRQSRLENVDPLARGEASVPHARVMGQF | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,591.019 | ||
Theoretical pI: | 4.764 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 17.519 | ||
aromaticity | 0.098 | ||
GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.241 | ||
sheet | 0.268 |