Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341127.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
HALKAINSQPPWLQFPLPSTSPTARRLSPSDDSLPARHFLKSFRQTCLPQKPKSILVISGHWETAEPSVNAVSGPSATIHDFYGFPDQMYRLKDPAPGSPELADRVKQLLNKSGFETVHV DDTRGLDHGAWVPLMLMYPEADIPVVQLSVQTDKDASHHYRLGEALRPLKEDGVLIFGSGAATHNLRKISRDGSNEVAEWAEEFDRWIGKALEEGRYEDVNRNEE | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 12,849.969 | ||
Theoretical pI: | 11.248 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 48.654 | ||
aromaticity | 0.026 | ||
GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.183 | ||
sheet | 0.278 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341127.1 | 5prime_partial | 115 | 676-329(-) |
Amino Acid sequence : | |||
LLIPIHILIPPLLQRLPDPPVKLLRPLRHLVAAVAADLPQIVRGGAGSEYQDAVLLQRPQRLAEAVVVRGVLVGLHRQLDHRNVRLRIHQHERDPRAVVQPARVVHVDGFESGFV* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,849.969 | ||
Theoretical pI: | 11.248 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 48.654 | ||
aromaticity | 0.026 | ||
GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.183 | ||
sheet | 0.278 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341127.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
HALKAINSQPPWLQFPLPSTSPTARRLSPSDDSLPARHFLKSFRQTCLPQKPKSILVISGHWETAEPSVNAVSGPSATIHDFYGFPDQMYRLKDPAPGSPELADRVKQLLNKSGFETVHV DDTRGLDHGAWVPLMLMYPEADIPVVQLSVQTDKDASHHYRLGEALRPLKEDGVLIFGSGAATHNLRKISRDGSNEVAEWAEEFDRWIGKALEEGRYEDVNRNEE | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 12,849.969 | ||
Theoretical pI: | 11.248 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 48.654 | ||
aromaticity | 0.026 | ||
GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.183 | ||
sheet | 0.278 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341127.1 | 5prime_partial | 115 | 676-329(-) |
Amino Acid sequence : | |||
LLIPIHILIPPLLQRLPDPPVKLLRPLRHLVAAVAADLPQIVRGGAGSEYQDAVLLQRPQRLAEAVVVRGVLVGLHRQLDHRNVRLRIHQHERDPRAVVQPARVVHVDGFESGFV* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,849.969 | ||
Theoretical pI: | 11.248 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 48.654 | ||
aromaticity | 0.026 | ||
GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.183 | ||
sheet | 0.278 |