| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341133.1 | internal | 216 | 3-650(+) |
Amino Acid sequence : | |||
| SQSPATASTASNPPLLDSIRDAIRRAKSESTSSAAAALITTADGNFFSNGYDVAWAQSDPDQFWTKAKAMSKKLRLLVEDLISLPMPTIAAVNGHATAAGFVLALCHDYILMRQDRGYLY MNELEIGYTIPNWMFQILRSKIESPKILKNVVLKAAKMNARTALEWEIVESAHADAADTVDAAVRLAADLEGRKWDGEVYAGSRRIFLAGVVAALG | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 23,118.763 | ||
| Theoretical pI: | 9.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 70.731 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.282 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341133.1 | 5prime_partial | 213 | 650-9(-) |
Amino Acid sequence : | |||
| AKRRHHTGKKNSPATGVNFPIPLPPLQIRRQPHRRIHRVRRVGVRRFHDFPLQRGARVHLRRLQHHILQNLGRFDLAPENLEHPIRNSVSDFELIHVEIPSVLAHQDVVVAEGQDEARGG GVAVHGGDGRHREGDEILHQKPEFFRHSLGFGPELIGIGLCPCDVVAVGEEVAVGGGDEGGGGGGGGLGLGAADSVSDGVEERGVRGGARRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 23,118.763 | ||
| Theoretical pI: | 9.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 70.731 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.282 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341133.1 | internal | 216 | 3-650(+) |
Amino Acid sequence : | |||
| SQSPATASTASNPPLLDSIRDAIRRAKSESTSSAAAALITTADGNFFSNGYDVAWAQSDPDQFWTKAKAMSKKLRLLVEDLISLPMPTIAAVNGHATAAGFVLALCHDYILMRQDRGYLY MNELEIGYTIPNWMFQILRSKIESPKILKNVVLKAAKMNARTALEWEIVESAHADAADTVDAAVRLAADLEGRKWDGEVYAGSRRIFLAGVVAALG | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 23,118.763 | ||
| Theoretical pI: | 9.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 70.731 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.282 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341133.1 | 5prime_partial | 213 | 650-9(-) |
Amino Acid sequence : | |||
| AKRRHHTGKKNSPATGVNFPIPLPPLQIRRQPHRRIHRVRRVGVRRFHDFPLQRGARVHLRRLQHHILQNLGRFDLAPENLEHPIRNSVSDFELIHVEIPSVLAHQDVVVAEGQDEARGG GVAVHGGDGRHREGDEILHQKPEFFRHSLGFGPELIGIGLCPCDVVAVGEEVAVGGGDEGGGGGGGGLGLGAADSVSDGVEERGVRGGARRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 23,118.763 | ||
| Theoretical pI: | 9.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 70.731 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.282 | ||
| sheet | 0.211 | ||