| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341155.1 | 5prime_partial | 180 | 604-62(-) |
Amino Acid sequence : | |||
| HNHQIGALAVAMKQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVIGGTENHLVVWDLGPLGLTGNKVEKLCDLCTITVNKNAVFGDSSALAPGGVRIGAPAMTWRGLVEKDFEQIAEF LHRAVSLTLKIQKEHGKLLKDFNKGLVNNKEIEEVKADVEKFSASLDMPGFLVSEMKYKE* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 14,445.609 | ||
| Theoretical pI: | 11.034 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 42.502 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.323 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341155.1 | complete | 130 | 57-449(+) |
Amino Acid sequence : | |||
| MHYSLYFISETRKPGISNEAENFSTSAFTSSISLLFTKPLLKSFSSLPCSFWIFKVRLTARWRNSAICSKSFSTSPLHVMAGAPMRTPPGAKALLSPNTAFLLTVMVHRSQSFSTLFPVN PRGPRSHTTK* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,445.609 | ||
| Theoretical pI: | 11.034 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 42.502 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.323 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341155.1 | 5prime_partial | 180 | 604-62(-) |
Amino Acid sequence : | |||
| HNHQIGALAVAMKQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVIGGTENHLVVWDLGPLGLTGNKVEKLCDLCTITVNKNAVFGDSSALAPGGVRIGAPAMTWRGLVEKDFEQIAEF LHRAVSLTLKIQKEHGKLLKDFNKGLVNNKEIEEVKADVEKFSASLDMPGFLVSEMKYKE* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 14,445.609 | ||
| Theoretical pI: | 11.034 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 42.502 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.323 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341155.1 | complete | 130 | 57-449(+) |
Amino Acid sequence : | |||
| MHYSLYFISETRKPGISNEAENFSTSAFTSSISLLFTKPLLKSFSSLPCSFWIFKVRLTARWRNSAICSKSFSTSPLHVMAGAPMRTPPGAKALLSPNTAFLLTVMVHRSQSFSTLFPVN PRGPRSHTTK* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,445.609 | ||
| Theoretical pI: | 11.034 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 42.502 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.323 | ||
| sheet | 0.223 | ||