| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341160.1 | internal | 126 | 379-2(-) |
Amino Acid sequence : | |||
| VFFKCQSSSAGVMTDASGIRKILPESEICDFDFDPCGYLRNAIEGDAVSTIHVTPEDGFSYASFETVGYDFGKMDLSLVLERVLCCFKPAKFSVGVHGGKDELKVELENCMCGERRCGGD GGWWKS | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,319.554 | ||
| Theoretical pI: | 9.872 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 44.784 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.246 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341160.1 | internal | 126 | 2-379(+) |
Amino Acid sequence : | |||
| TLPPSPITSTSPFSTHAILQLHLQLILPPMNTNRKLGWLEAAQNPLQNKTQIHFPKIIPNCLEACITEPIFWGHMNCRHGVSFNCIPQVTARVKIKVAYLRFRKDFPDAGRISHDTSRAR LTLEKN | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,319.554 | ||
| Theoretical pI: | 9.872 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 44.784 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.246 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341160.1 | internal | 126 | 379-2(-) |
Amino Acid sequence : | |||
| VFFKCQSSSAGVMTDASGIRKILPESEICDFDFDPCGYLRNAIEGDAVSTIHVTPEDGFSYASFETVGYDFGKMDLSLVLERVLCCFKPAKFSVGVHGGKDELKVELENCMCGERRCGGD GGWWKS | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,319.554 | ||
| Theoretical pI: | 9.872 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 44.784 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.246 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341160.1 | internal | 126 | 2-379(+) |
Amino Acid sequence : | |||
| TLPPSPITSTSPFSTHAILQLHLQLILPPMNTNRKLGWLEAAQNPLQNKTQIHFPKIIPNCLEACITEPIFWGHMNCRHGVSFNCIPQVTARVKIKVAYLRFRKDFPDAGRISHDTSRAR LTLEKN | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,319.554 | ||
| Theoretical pI: | 9.872 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 44.784 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.246 | ||
| sheet | 0.214 | ||