| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341164.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
| APPEGELHAQAWDHAPFYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGT PLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHD WSDD | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 15,974.120 | ||
| Theoretical pI: | 11.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 68.872 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.590 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.206 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341164.1 | 3prime_partial | 141 | 423-1(-) |
Amino Acid sequence : | |||
| MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEYEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVKGGVVPCLCMKFTFRGC | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,974.120 | ||
| Theoretical pI: | 11.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 68.872 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.590 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.206 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341164.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
| APPEGELHAQAWDHAPFYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGT PLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHD WSDD | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 15,974.120 | ||
| Theoretical pI: | 11.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 68.872 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.590 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.206 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341164.1 | 3prime_partial | 141 | 423-1(-) |
Amino Acid sequence : | |||
| MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEYEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVKGGVVPCLCMKFTFRGC | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,974.120 | ||
| Theoretical pI: | 11.071 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 68.872 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.590 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.206 | ||
| sheet | 0.227 | ||