Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341164.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
APPEGELHAQAWDHAPFYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGT PLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHD WSDD | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 15,974.120 | ||
Theoretical pI: | 11.071 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 68.872 | ||
aromaticity | 0.064 | ||
GRAVY | -0.590 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.206 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341164.1 | 3prime_partial | 141 | 423-1(-) |
Amino Acid sequence : | |||
MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEYEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVKGGVVPCLCMKFTFRGC | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,974.120 | ||
Theoretical pI: | 11.071 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 68.872 | ||
aromaticity | 0.064 | ||
GRAVY | -0.590 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.206 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341164.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
APPEGELHAQAWDHAPFYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGT PLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHD WSDD | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 15,974.120 | ||
Theoretical pI: | 11.071 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 68.872 | ||
aromaticity | 0.064 | ||
GRAVY | -0.590 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.206 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341164.1 | 3prime_partial | 141 | 423-1(-) |
Amino Acid sequence : | |||
MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEYEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVKGGVVPCLCMKFTFRGC | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,974.120 | ||
Theoretical pI: | 11.071 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 68.872 | ||
aromaticity | 0.064 | ||
GRAVY | -0.590 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.206 | ||
sheet | 0.227 |