| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341166.1 | complete | 239 | 748-29(-) |
Amino Acid sequence : | |||
| MAAYFLLQNSPALLDGWVKLSSRTLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQIMGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVAFAAPPLHGV QHVGGDMFKEVPKADAVFIMWVMHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGSKYINGIRLSLHMVMLAHTDTGRQRSIEEWKYVLNGTGFSSYTVKDIDSIISTIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 16,305.519 | ||
| Theoretical pI: | 10.853 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 62.774 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.527 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.243 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341166.1 | 3prime_partial | 144 | 317-748(+) |
Amino Acid sequence : | |||
| MHYPHDENSVSLGNLFEHVPSYMLNAMEGRRCKRNVREIKINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTHDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSLIGE GARAQLHPPIQQRRAVLQQKIRRH | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,305.519 | ||
| Theoretical pI: | 10.853 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 62.774 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.527 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.243 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341166.1 | complete | 239 | 748-29(-) |
Amino Acid sequence : | |||
| MAAYFLLQNSPALLDGWVKLSSRTLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQIMGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVAFAAPPLHGV QHVGGDMFKEVPKADAVFIMWVMHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGSKYINGIRLSLHMVMLAHTDTGRQRSIEEWKYVLNGTGFSSYTVKDIDSIISTIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 16,305.519 | ||
| Theoretical pI: | 10.853 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 62.774 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.527 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.243 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341166.1 | 3prime_partial | 144 | 317-748(+) |
Amino Acid sequence : | |||
| MHYPHDENSVSLGNLFEHVPSYMLNAMEGRRCKRNVREIKINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTHDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSLIGE GARAQLHPPIQQRRAVLQQKIRRH | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,305.519 | ||
| Theoretical pI: | 10.853 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 62.774 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.527 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.243 | ||
| sheet | 0.257 | ||