| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341168.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
| CSTCRTLCSLFVIAGLLPSARGDLTSDSQALLAFSTAVPHGRKLNWNAASPVCMWTGVNCSSDGKSVIGLRLPGVGLTGPIPSNTIGKLDALRVLSFRANRLSGSLPSDVFSLPSLHYVF LQNNNFSGEIPASLPPQLAVLDLSFNSLTGSIPLTFRNLTHLTALSLQNNSLSGPIPDIDLPHLKRFNVSYNQFNGSIPSSLTVFPNSSFVGNFLCGPPLSPCFPLSPSPSP | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 24,522.851 | ||
| Theoretical pI: | 8.797 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 42.000 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.401 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341168.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
| CSTCRTLCSLFVIAGLLPSARGDLTSDSQALLAFSTAVPHGRKLNWNAASPVCMWTGVNCSSDGKSVIGLRLPGVGLTGPIPSNTIGKLDALRVLSFRANRLSGSLPSDVFSLPSLHYVF LQNNNFSGEIPASLPPQLAVLDLSFNSLTGSIPLTFRNLTHLTALSLQNNSLSGPIPDIDLPHLKRFNVSYNQFNGSIPSSLTVFPNSSFVGNFLCGPPLSPCFPLSPSPSP | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 24,522.851 | ||
| Theoretical pI: | 8.797 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 42.000 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.210 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.401 | ||
| sheet | 0.216 | ||