| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341173.1 | 5prime_partial | 164 | 2-496(+) |
Amino Acid sequence : | |||
| HARSTITLSLGKPIFNLVSHPSEIAYKRRCSARFRMSSDQPKLEVGAEVLLLKGNQVLLGRRRTAIGYGHFALPGGHLEFGESFKECAVREVKEETGLEINGVEFLTVTSNVVLDPKPAQ LIAVFMRASLVDPTQEPINLEPEKCDSWGWYDWNNLPRPLLITL* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 18,355.934 | ||
| Theoretical pI: | 7.086 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 42.244 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.163 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.250 | ||
| sheet | 0.287 | ||