Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341173.1 | 5prime_partial | 164 | 2-496(+) |
Amino Acid sequence : | |||
HARSTITLSLGKPIFNLVSHPSEIAYKRRCSARFRMSSDQPKLEVGAEVLLLKGNQVLLGRRRTAIGYGHFALPGGHLEFGESFKECAVREVKEETGLEINGVEFLTVTSNVVLDPKPAQ LIAVFMRASLVDPTQEPINLEPEKCDSWGWYDWNNLPRPLLITL* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,355.934 | ||
Theoretical pI: | 7.086 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 42.244 | ||
aromaticity | 0.079 | ||
GRAVY | -0.163 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.250 | ||
sheet | 0.287 |