Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341183.1 | 5prime_partial | 130 | 2-394(+) |
Amino Acid sequence : | |||
HAVISKSTEDKAALDSLKNAFRAAEAVEEFTGIVMSLKMELDDAIGLSGENVRPLPEEYQKAIKTLFTTYVDYLAAFEPKETYLKKKVETELGSKMIYLKMRCGGLEADWGKVTVLGTSG LSGSYVEQRA* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,332.268 | ||
Theoretical pI: | 5.276 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 27.070 | ||
aromaticity | 0.085 | ||
GRAVY | -0.221 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.185 | ||
sheet | 0.346 |