| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341192.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| SPPLPSYSLHHSVIFPFLAKEKWLPTSIGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSDAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMA RGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQ LDAFTKAYADLESSL | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,516.379 | ||
| Theoretical pI: | 5.588 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 53860 | ||
| Instability index: | 32.147 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.239 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341192.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| SPPLPSYSLHHSVIFPFLAKEKWLPTSIGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSDAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMA RGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQ LDAFTKAYADLESSL | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,516.379 | ||
| Theoretical pI: | 5.588 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 53860 | ||
| Instability index: | 32.147 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.104 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.239 | ||
| sheet | 0.286 | ||