Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341193.1 | 5prime_partial | 201 | 3-608(+) |
Amino Acid sequence : | |||
NLVYPFYFQVFRHTATGTMIRLFKVKEKQRELAESANGKAPVKKQSAGELRLQKDISELNLPKTCTISFPNGKDDLMNFEVTIRPDEGYYLSGTFVFSFQISPIYPHEAPKVKCKTKVYH PNIDLEGNVCLNILREDWKPVLNINTIIYGLYHLFTEPNHEDPLNHDAAAVLRDNPKMFESNVRRAMSGGYVGQTFFPRCI* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 23,075.225 | ||
Theoretical pI: | 8.607 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
Instability index: | 47.704 | ||
aromaticity | 0.114 | ||
GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.239 | ||
sheet | 0.219 |