| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341195.1 | 3prime_partial | 217 | 92-742(+) |
Amino Acid sequence : | |||
| MALKLCVTPCKMPSFPGSQLRSHRVSMASTIHSPSIDAGKVKKPFSPPREVHVQVTHPLPPEKREIFNSLQDWAEENILVLLKPVEKCWQPSDFLPEPSSEGFDEQVRELRKRAKELPDD YLVVLVGDMITEEALPTYQTMLNTLDGGVRDETGASLTPWAIWTRAWTAEENRHGDLLNKYLYLTGRVDMRQIEKTIQYLIGSGMDPGTDKNPYLGF | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 24,606.884 | ||
| Theoretical pI: | 5.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
| Instability index: | 49.440 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.467 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.240 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341195.1 | 3prime_partial | 217 | 92-742(+) |
Amino Acid sequence : | |||
| MALKLCVTPCKMPSFPGSQLRSHRVSMASTIHSPSIDAGKVKKPFSPPREVHVQVTHPLPPEKREIFNSLQDWAEENILVLLKPVEKCWQPSDFLPEPSSEGFDEQVRELRKRAKELPDD YLVVLVGDMITEEALPTYQTMLNTLDGGVRDETGASLTPWAIWTRAWTAEENRHGDLLNKYLYLTGRVDMRQIEKTIQYLIGSGMDPGTDKNPYLGF | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 24,606.884 | ||
| Theoretical pI: | 5.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
| Instability index: | 49.440 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.467 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.240 | ||
| sheet | 0.263 | ||