| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341197.1 | 5prime_partial | 162 | 637-149(-) |
Amino Acid sequence : | |||
| LNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILQIVKENFDFRPGMISIN LDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKWEKSEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 16,752.572 | ||
| Theoretical pI: | 11.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44000 44500 | ||
| Instability index: | 72.978 | ||
| aromaticity | 0.085 | ||
| GRAVY | -1.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.261 | ||
| sheet | 0.148 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341197.1 | 5prime_partial | 142 | 635-207(-) |
Amino Acid sequence : | |||
| QPIWPLCHRRSTRRCWSHRSQDHHRHLRWLGSSRRWCFLREGPNQGGPEWGLHREAGCQEHCGKWIGTQVHRAGLVRNRCSRAFVGVCRQLRNWKDPRQGNPADCEGEFRLQTGNDFDQS GPQERRQWQIPQDRGVRALRSG* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,752.572 | ||
| Theoretical pI: | 11.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44000 44500 | ||
| Instability index: | 72.978 | ||
| aromaticity | 0.085 | ||
| GRAVY | -1.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.261 | ||
| sheet | 0.148 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341197.1 | 5prime_partial | 162 | 637-149(-) |
Amino Acid sequence : | |||
| LNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILQIVKENFDFRPGMISIN LDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKWEKSEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 16,752.572 | ||
| Theoretical pI: | 11.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44000 44500 | ||
| Instability index: | 72.978 | ||
| aromaticity | 0.085 | ||
| GRAVY | -1.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.261 | ||
| sheet | 0.148 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341197.1 | 5prime_partial | 142 | 635-207(-) |
Amino Acid sequence : | |||
| QPIWPLCHRRSTRRCWSHRSQDHHRHLRWLGSSRRWCFLREGPNQGGPEWGLHREAGCQEHCGKWIGTQVHRAGLVRNRCSRAFVGVCRQLRNWKDPRQGNPADCEGEFRLQTGNDFDQS GPQERRQWQIPQDRGVRALRSG* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,752.572 | ||
| Theoretical pI: | 11.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44000 44500 | ||
| Instability index: | 72.978 | ||
| aromaticity | 0.085 | ||
| GRAVY | -1.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.261 | ||
| sheet | 0.148 | ||