| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341208.1 | 5prime_partial | 124 | 434-60(-) |
Amino Acid sequence : | |||
| PEASCRIRHEEAMGFEKEVLRNGNGPKPAVGQKVSVHCTGFGKNGDLTQKFWSPKDQGQQPFSFEIGKGKVITGWDEGVLGMHLGEVGRLRCSPDYAYGAGGFPAWGIQPNSVLVFEIEV LSME* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,455.655 | ||
| Theoretical pI: | 10.846 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 53.861 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.263 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.233 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341208.1 | 5prime_partial | 120 | 433-71(-) |
Amino Acid sequence : | |||
| PRPRAEFGTRKQWVLRRKSLGTATAPSPLSARKSPFTVLVSAKTVISPKSSGAPRIKDSSLSLSKLAKAKLLQDGMKACWECTWEKLVDYDALPTMRMVRVVSQHGAFSQTLFWFSRLKF * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,455.655 | ||
| Theoretical pI: | 10.846 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 53.861 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.263 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.233 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341208.1 | 5prime_partial | 124 | 434-60(-) |
Amino Acid sequence : | |||
| PEASCRIRHEEAMGFEKEVLRNGNGPKPAVGQKVSVHCTGFGKNGDLTQKFWSPKDQGQQPFSFEIGKGKVITGWDEGVLGMHLGEVGRLRCSPDYAYGAGGFPAWGIQPNSVLVFEIEV LSME* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,455.655 | ||
| Theoretical pI: | 10.846 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 53.861 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.263 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.233 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341208.1 | 5prime_partial | 120 | 433-71(-) |
Amino Acid sequence : | |||
| PRPRAEFGTRKQWVLRRKSLGTATAPSPLSARKSPFTVLVSAKTVISPKSSGAPRIKDSSLSLSKLAKAKLLQDGMKACWECTWEKLVDYDALPTMRMVRVVSQHGAFSQTLFWFSRLKF * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,455.655 | ||
| Theoretical pI: | 10.846 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 53.861 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.263 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.233 | ||
| sheet | 0.250 | ||