| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341215.1 | 5prime_partial | 201 | 3-608(+) |
Amino Acid sequence : | |||
| NLGYPFYFQVFRHTATGTMIRLFKVKEKPPELAESANGKAPVKKQSAGELRLQKDISELNLPKTCTISFPNGKDDLMNFEVTIRPDEGYYLSGTFVFSFQISPIYPHEAPKVKCKTKVYH PNIDLEGNVCLNILREDWKPVLNINTIIYGLYHLFTEPNHEDPLNHDAAAVLRDNPKMFESNVRRAMSGGYVGQTFFPRCI* | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 22,943.060 | ||
| Theoretical pI: | 8.311 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
| Instability index: | 47.928 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.391 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.254 | ||
| sheet | 0.219 | ||