| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341239.1 | 3prime_partial | 147 | 178-618(+) |
Amino Acid sequence : | |||
| MRFLTHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGAFVLLQGAQRGPSACITAQGLKSRERPGVEELGSDPLYEDPIFTKKVFRDAMACHARLTTSAVIENYGEGFRGVGSLVDVG GSYGMTLGMLVEAFPWIRGICYDLPQV | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,952.968 | ||
| Theoretical pI: | 6.283 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 39.597 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.259 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341239.1 | 3prime_partial | 147 | 178-618(+) |
Amino Acid sequence : | |||
| MRFLTHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGAFVLLQGAQRGPSACITAQGLKSRERPGVEELGSDPLYEDPIFTKKVFRDAMACHARLTTSAVIENYGEGFRGVGSLVDVG GSYGMTLGMLVEAFPWIRGICYDLPQV | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,952.968 | ||
| Theoretical pI: | 6.283 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 39.597 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.259 | ||
| sheet | 0.259 | ||