| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341243.1 | internal | 218 | 1-654(+) |
Amino Acid sequence : | |||
| RKGEEMASSCLCYSENFSSVSLNPNKPFTSPPNQFLAASRFSKLPSLTFPSSQNLSQTHFRKSKSVPGLLVDASAGKAEPLRVMISGAPASGKGTQCELITKKYDLVHIAAGDLLRAEVA AGTENGKRAKEFMEKGQLVPDEIVVMMVKERLSQQDSLENGWLLDGYPRSESHATALKKLGFDPDIFILLEVPEDILVERVVGRRLDPVTGNIYHLKY | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 13,614.471 | ||
| Theoretical pI: | 11.381 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 87.207 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.344 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341243.1 | 5prime_partial | 122 | 653-285(-) |
Amino Acid sequence : | |||
| YLRWYMFPVTGSSLRPTTLSTRISSGTSRRMKISGSKPSFLRAVAWDSLRGYPSRSQPFSKESCWDNRSLTIMTTISSGTSWPFSINSLARFPFSVPAATSALRRSPAAMCTKSYFLVIS SH* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,614.471 | ||
| Theoretical pI: | 11.381 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 87.207 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.344 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341243.1 | internal | 218 | 1-654(+) |
Amino Acid sequence : | |||
| RKGEEMASSCLCYSENFSSVSLNPNKPFTSPPNQFLAASRFSKLPSLTFPSSQNLSQTHFRKSKSVPGLLVDASAGKAEPLRVMISGAPASGKGTQCELITKKYDLVHIAAGDLLRAEVA AGTENGKRAKEFMEKGQLVPDEIVVMMVKERLSQQDSLENGWLLDGYPRSESHATALKKLGFDPDIFILLEVPEDILVERVVGRRLDPVTGNIYHLKY | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 13,614.471 | ||
| Theoretical pI: | 11.381 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 87.207 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.344 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341243.1 | 5prime_partial | 122 | 653-285(-) |
Amino Acid sequence : | |||
| YLRWYMFPVTGSSLRPTTLSTRISSGTSRRMKISGSKPSFLRAVAWDSLRGYPSRSQPFSKESCWDNRSLTIMTTISSGTSWPFSINSLARFPFSVPAATSALRRSPAAMCTKSYFLVIS SH* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,614.471 | ||
| Theoretical pI: | 11.381 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 87.207 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.344 | ||
| sheet | 0.180 | ||