Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341260.1 | 5prime_partial | 142 | 2-430(+) |
Amino Acid sequence : | |||
AQGKYIMCPFLKQNYQLCEKVGRGRFGVSYRCFSGAANDSFACKSIYRHSLSDPTDRRCIDTEPKILHLLSGCPNILRLHDVYEDDDYIHLVTDLCDGGDLFDRISSGNRFSEPDAAAIL KQLMTAVAYCTPVKRPASRYQA* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 11,870.062 | ||
Theoretical pI: | 10.543 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 68.071 | ||
aromaticity | 0.042 | ||
GRAVY | -0.202 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.395 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341260.1 | 5prime_partial | 119 | 3-362(+) |
Amino Acid sequence : | |||
HKGNISCALSSSKTTNCAKRSGAADSASLTAASPGPPTTPLPANPSIGTRSLTPPTAAASTQSLRFSTFSPVALIFSASTTSTKTTTTSTSSPISATEAIYSTASPPAIASRNPTPPRF* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 11,870.062 | ||
Theoretical pI: | 10.543 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 68.071 | ||
aromaticity | 0.042 | ||
GRAVY | -0.202 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.395 | ||
sheet | 0.210 |