| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341260.1 | 5prime_partial | 142 | 2-430(+) |
Amino Acid sequence : | |||
| AQGKYIMCPFLKQNYQLCEKVGRGRFGVSYRCFSGAANDSFACKSIYRHSLSDPTDRRCIDTEPKILHLLSGCPNILRLHDVYEDDDYIHLVTDLCDGGDLFDRISSGNRFSEPDAAAIL KQLMTAVAYCTPVKRPASRYQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 11,870.062 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 68.071 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.202 | ||
Secondary Structure Fraction | |||
| Helix | 0.151 | ||
| turn | 0.395 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341260.1 | 5prime_partial | 119 | 3-362(+) |
Amino Acid sequence : | |||
| HKGNISCALSSSKTTNCAKRSGAADSASLTAASPGPPTTPLPANPSIGTRSLTPPTAAASTQSLRFSTFSPVALIFSASTTSTKTTTTSTSSPISATEAIYSTASPPAIASRNPTPPRF* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 11,870.062 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 68.071 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.202 | ||
Secondary Structure Fraction | |||
| Helix | 0.151 | ||
| turn | 0.395 | ||
| sheet | 0.210 | ||